ZNF593 Polyclonal antibody

• 

  WB analysis of mouse spleen using 19426-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 19426-1-AP (ZNF593 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 19426-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 19426-1-AP (ZNF593 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

ZNF593 Polyclonal Antibody for WB, ELISA

Cat No. 19426-1-AP

Publications(3)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF, CoIP, ELISA

Synonyms

zinc finger protein 593, Zinc finger protein T86, ZNF593, ZT86

---

Tested Applications

• Positive WB detected in: mouse spleen tissue, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 3 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

19426-1-AP targets ZNF593 in WB, IF, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13758

  Product name: Recombinant human ZNF593 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-134 aa of BC002580

  Sequence: MGRSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST

• Full Name: zinc finger protein 593
• Calculated Molecular Weight: 134 aa, 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC002580
• Gene Symbol: ZNF593
• Gene ID (NCBI): 51042
• RRID: AB_10642948
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00488
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Exp Cell Res; Zinc finger protein 593 is upregulated during skeletal muscle atrophy and modulates muscle cell differentiation.; Authors - Sarah A Lynch
human	WB	iScience; Zinc finger protein 593 promotes breast cancer development by ensuring DNA damage repair and cell-cycle progression; Authors - Yingfan Zhang ; KD Validated
human,mouse	WB,IF,CoIP	Cell Death Differ; ZNF593 regulates the cGAS-mediated innate immune response by attenuating cGAS-DNA binding; Authors - Xuemei Bai ; KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Sun (Verified Customer) (01-05-2023)

A single band was detected in the HEK293T lysates.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HEK293T

FH

David (Verified Customer) (06-01-2019)

Antibody works great for western blot

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: C2C12

ZNF593 Antibody Western Blot, validation (1:1000 dilution) in C2C12 (Cat no:19426-1-AP)