ZNF618 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF618 Polyclonal antibody, PBS Only (31972-1-PBS)

• 

  WB analysis using 31972-1-AP (same clone as 31972-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31972-1-AP (ZNF618 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31972-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 31972-1-AP (same clone as 31972-1-PBS)

  WB result of ZNF618 antibody (31972-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-ZNF618 transfected SH-SY5Y cells. This data was developed using the same antibody clone with 31972-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 31972-1-AP (same clone as 31972-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 31972-1-AP (ZNF618 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31972-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 31972-1-AP (same clone as 31972-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 31972-1-AP (ZNF618 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31972-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 31972-1-AP (same clone as 31972-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using ZNF618 antibody (31972-1-AP) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 31972-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ZNF618 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 31972-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

KIAA1952, Zinc finger protein 618

---

Product Information

31972-1-PBS targets ZNF618 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36487

  Product name: Recombinant human ZNF618 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 200-382 aa of NM_001318042.1

  Sequence: YSCFQEHRDLHAVDVFSVEGAPENRADPFDQGVVATDEVKEEPPEPFQKIGPKTGNYTCEFCGKQYKYYTPYQEHVALHAPISTAPGWEPPDDPDTGSECSHPEVSPSPRFVAAKTQTNQSGKKAPASVVRCATLLHRTPPATQTQTFRTPNSGSPASKATAAESAFSRRVEGKAQNHFEETN

• Full Name: zinc finger protein 618
• Calculated Molecular Weight: 105kDa，954aa
• Observed Molecular Weight: 100-113 kDa
• GenBank Accession Number: NM_001318042.1
• Gene Symbol: ZNF618
• Gene ID (NCBI): 114991
• RRID: AB_3670163
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5T7W0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Zinc finger protein 618 (ZNF618) is a key protein associated with DNA methylation and acts as a specific 5hmC reader in vivo to regulate UHRF2 function by promoting UHRF2 chromatin localization. In addition, ZNF618 is not only associated with the induction, maintenance or progression of female breast cancer, but is also up-regulated in lung cancer cells.