ZNF641 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF641 Polyclonal antibody, PBS Only (26302-1-PBS)

• 

  WB analysis using 26302-1-AP (same clone as 26302-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26302-1-AP (ZNF641 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26302-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 26302-1-AP (same clone as 26302-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using ZNF641 antibody (26302-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 26302-1-PBS in a different storage buffer formulation.

ZNF641 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 26302-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

26302-1-PBS targets ZNF641 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23672

  Product name: Recombinant human ZNF641 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-118 aa of BC018090

  Sequence: MLSEQTAALGTRWESMNVQLDGAEPQVERGSQEERPWRTVPGPLEHLCCDLEEEPQSLQEKAQSAPWVPAIPQEGNTGDWEMAAALLAAGSQGLVTIKDVSLCFSQEEWRSLDPSQTD

• Full Name: zinc finger protein 641
• Observed Molecular Weight: 40-45 kDa, 50-55 kDa
• GenBank Accession Number: BC018090
• Gene Symbol: ZNF641
• Gene ID (NCBI): 121274
• RRID: AB_3085853
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96N77
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Zinc finger protein 641(ZNF 641) encodes a zinc-finger protein with five different C2H2 type zinc fingers and a KRAB-A box. Northern blot analysis indicates that ZNF641 is expressed in most of the examined adult tissues, at a high level in skeletal muscle. The ZNF 641 protein contains 438 amino acids and has 4 isoforms (50,43,47,48 kDa) produced by alternative splicing.