ZNF645 Polyclonal antibody

ZNF645 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 25600-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

HAKAIL, zinc finger protein 645, ZNF645

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman testis tissue
Positive IHC detected inhuman prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25600-1-AP targets ZNF645 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22346

Product name: Recombinant human ZNF645 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 287-425 aa of BC126190

Sequence: SPSSPVNHQMPYPPQDVVTPNSVRSQVPALTTTYDPSSGYIIVKVPPDMNSPPLRAPQSQNGNPSASEFASHHYNLNILPQFTENQETLSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQRRHRRY

Predict reactive species
Full Name zinc finger protein 645
Calculated Molecular Weight 425 aa, 49 kDa
Observed Molecular Weight 49 kDa
GenBank Accession NumberBC126190
Gene Symbol ZNF645
Gene ID (NCBI) 158506
RRIDAB_2880153
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N7E2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for ZNF645 antibody 25600-1-APDownload protocol
WB protocol for ZNF645 antibody 25600-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Mi (Verified Customer) (05-29-2023)

It works well in human white adipocytes, we get two bands, with the lower band at the predicted size.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: adipocytes
Loading...
||
New chat Able
正在加载,请稍候...