ZNF645 Polyclonal antibody

• 

  WB analysis of human testis using 25600-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 25600-1-AP (ZNF645 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 25600-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25600-1-AP (ZNF645 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 25600-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25600-1-AP (ZNF645 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ZNF645 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25600-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

HAKAIL, zinc finger protein 645, ZNF645

---

Tested Applications

• Positive WB detected in: human testis tissue
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25600-1-AP targets ZNF645 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22346

  Product name: Recombinant human ZNF645 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 287-425 aa of BC126190

  Sequence: SPSSPVNHQMPYPPQDVVTPNSVRSQVPALTTTYDPSSGYIIVKVPPDMNSPPLRAPQSQNGNPSASEFASHHYNLNILPQFTENQETLSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQRRHRRY

• Full Name: zinc finger protein 645
• Calculated Molecular Weight: 425 aa, 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC126190
• Gene Symbol: ZNF645
• Gene ID (NCBI): 158506
• RRID: AB_2880153
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N7E2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Mi (Verified Customer) (05-29-2023)

It works well in human white adipocytes, we get two bands, with the lower band at the predicted size.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: adipocytes