ZNF649 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84624-4-RR (same clone as 84624-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84624-4-RR (ZNF649 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84624-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84624-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84624-4-RR against Human ZNF649 were performed. The affinity constant is 4.71 nM.

ZNF649 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84624-4-PBS

Clone No.242036C7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Zinc finger protein 649, 242036C7

---

Product Information

84624-4-PBS targets ZNF649 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22700

  Product name: Recombinant human ZNF649 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 66-183 aa of BC005368

  Sequence: LWTLEDEIHSPAHPEIEKADDHLQQPLQNQKILKRTGQRYEHGRTLKSYLGLTNQSRRYNRKEPAEFNGDGAFLHDNHEQMPTEIEFPESRKPISTKSQFLKHQQTHNIEKAHECTDC

• Full Name: zinc finger protein 649
• Calculated Molecular Weight: 505 aa, 58 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC005368
• Gene Symbol: ZNF649
• Gene ID (NCBI): 65251
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9BS31
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF649, also named as Zinc finger protein 649, is a 505 amino acid protein, which contains The one KRAB domain and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF649 is highly expressed in heart, skeletal muscle, and brain and lower expression in liver, lung, kidney, pancreas and placenta. ZNF649 as a regulator of transcriptional factor complexes may suppress SRE and AP-1 transcription activities by growth factor signaling pathways.