ZNF671 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF671 Polyclonal antibody (21329-1-AP)

• Featured Product
• KD/KO Validated

ZNF671 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 21329-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Zinc finger protein 671

• 

  WB analysis using 21329-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21329-1-AP (ZNF671 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 21329-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21329-1-AP (ZNF671 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U-251 using 21329-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using ZNF671 antibody (21329-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ZNF671 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HepG2 cells, HeLa cells, MCF-7 cells, MDA-MB-231 cells, SKOV-3 cells, U-251 cells
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21329-1-AP targets ZNF671 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15319

  Product name: Recombinant human ZNF671 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 207-556 aa of BC025728

  Sequence: FDQHQNQPNGGKLFPRKEGRDSVKSCRVHVPEKTLTCGKGRRDFSATSGLLQHQASLSSMKPHKSTKLVSGFLMGQRYHRCGECGKAFTRKDTLARHQRIHTGERPYECNECGKFFSQSYDLFKHQTVHTGERPYECSECGKFFRQISGLIEHRRVHTGERLYQCGKCGKFFSSKSNLIRHQEVHTGARPYVCSECGKEFSRKHTLVLHQRTHTGERPYECSECGKAFSQSSHLNVHWRIHSSDYECSRCGKAFSCISKLIQHQKVHSGEKPYECSKCGKAFTQRPNLIRHWKVHTGERPYVCSECGREFIRKQTLVLHQRVHAGEKLKSVANVGESLRPMPLTYYMVGN

• Full Name: zinc finger protein 671
• Calculated Molecular Weight: 556 aa, 63 kDa
• Observed Molecular Weight: 61-70 kDa
• GenBank Accession Number: BC025728
• Gene Symbol: ZNF671
• Gene ID (NCBI): 79891
• RRID: AB_10755298
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TAW3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ZNF671 Polyclonal antibody (Cat# 21329-1-AP) has a total of 4 citations. These publications appear in three journals: Journal of Experimental & Clinical Cancer Research, International Journal of Biological Sciences, and Frontiers in Oncology (two papers). All citations are associated with oncology/cancer biology research, specifically investigating ZNF671's tumor suppressor role in nasopharyngeal carcinoma, laryngeal carcinoma, and multiple solid tumors through epigenetic regulation mechanisms.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Exp Clin Cancer Res; Epigenetic mediated zinc finger protein 671 downregulation promotes cell proliferation and tumorigenicity in nasopharyngeal carcinoma by inhibiting cell cycle arrest.; Authors - Jian Zhang ; KD Validated
human	WB	Int J Biol Sci; Increased methylation of ZNF671 suppresses tumor progression by promoting MAPK6 transcription in laryngeal carcinoma; Authors - Wei Zhang
human	WB	Front Oncol; Epigenetic-Mediated Downregulation of Zinc Finger Protein 671 (ZNF671) Predicts Poor Prognosis in Multiple Solid Tumors.; Authors - Jian Zhang
human	WB	Front Oncol; The Tumor Suppressor Role of Zinc Finger Protein 671 (ZNF671) in Multiple Tumors Based on Cancer Single-Cell Sequencing.; Authors - Jian Zhang