ZNF674 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF674 Polyclonal antibody, PBS Only (24747-1-PBS)

• 

  WB analysis using 24747-1-AP (same clone as 24747-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24747-1-AP (ZNF674 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24747-1-PBS in a different storage buffer formulation.

ZNF674 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24747-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24747-1-PBS targets ZNF674 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21576

  Product name: Recombinant human ZNF674 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 99-193 aa of BC157038

  Sequence: SQDKFLWQAAFIGKETLKDESGQECKICRKIIYLNTDFVSVKQRLPKYYSWERCSKHHLNFLGQNRSYVRKKDDGCKAYWKVCLHYNLHKAQPAE

• Full Name: zinc finger family member 674
• Calculated Molecular Weight: 581 aa, 67 kDa
• Observed Molecular Weight: 63-67 kDa
• GenBank Accession Number: BC157038
• Gene Symbol: ZNF674
• Gene ID (NCBI): 641339
• RRID: AB_2879703
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2M3X9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.