ZNF688 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF688 Polyclonal antibody (33770-1-AP)

• 

  WB analysis using 33770-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33770-1-AP (ZNF688 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A-673 using 33770-1-AP

  IP result of anti-ZNF688 (IP:33770-1-AP, 4ug; Detection:33770-1-AP 1:500) with A-673 cells lysate 1400 ug.

ZNF688 Polyclonal Antibody for WB, IP, ELISA

Cat No. 33770-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

Zinc finger protein 688

---

Tested Applications

• Positive WB detected in: A-673 cells, SK-N-SH cells
• Positive IP detected in: A-673 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33770-1-AP targets ZNF688 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37821

  Product name: Recombinant human ZNF688 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 94-276 aa of BC018997

  Sequence: KGERLGGARRGDVPNRKEEEPEEVPRAKGPRKAPVKESPEVLVERNPDPAISVAPARAQPPKNAAWDPTTGAQPPAPIPSMDAQAGQRRHVCTDCGRRFTYPSLLVSHRRMHSGERPFPCPECGMRFKRKFAVEAHQWIHRSCSGGRRGRRPGIRAVPRAPVRGDRDPPVLFRHYPDIFEECG

• Full Name: zinc finger protein 688
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC018997
• Gene Symbol: ZNF688
• Gene ID (NCBI): 146542
• RRID: AB_3743074
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P0C7X2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZNF688 encodes a C2H2-type zinc finger transcription factor that likely regulates gene expression and chromatin structure in a nucleus-localized manner. Though functionally understudied, it is predicted to act as a context-dependent transcriptional modulator influencing cell differentiation, stress responses, and tumor-associated transcriptional remodeling. Emerging transcriptomic evidence implicates ZNF688 in epigenetic control and cancer-related gene regulation, aligning it with broader zinc finger-mediated regulatory networks. (PMID: 30041579)