ZNF689 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF689 Polyclonal antibody, PBS Only (25573-1-PBS)

• 

  WB analysis using 25573-1-AP (same clone as 25573-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25573-1-AP (ZNF689 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25573-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 25573-1-AP (same clone as 25573-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25573-1-AP (ZNF689 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25573-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 25573-1-AP (same clone as 25573-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 25573-1-AP (ZNF689 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 25573-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 25573-1-AP (same clone as 25573-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25573-1-AP (ZNF689 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 25573-1-PBS in a different storage buffer formulation.

ZNF689 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25573-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

TIPUH1

---

Product Information

25573-1-PBS targets ZNF689 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22252

  Product name: Recombinant human ZNF689 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 77-173 aa of BC014000

  Sequence: LISWLERNTDDWEPAALDPQEYPRGLTVQRKSRTRKKNGEKEVFPPKEAPRKGKRGRRPSKPRLIPRQTSGGPICPDCGCTFPDHQALESHKCAQNL

• Full Name: zinc finger protein 689
• Calculated Molecular Weight: 500 aa, 57 kDa
• Observed Molecular Weight: 50-57 kDa
• GenBank Accession Number: BC014000
• Gene Symbol: ZNF689
• Gene ID (NCBI): 115509
• RRID: AB_2880134
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96CS4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF689, a C2H2-type of Krüppel-associated box (KRAB)-zinc finger protein, is a putative transcription regulating factor. ZNF689 knockdown induced expression of the pro-apoptotic factors of the Bcl-2 family, Bax, Bcl-2 antagonist/killer 1 and Bid, resulting in tumor cell apoptosis (PMID: 21624362). ZNF689 was identified to be involved in suppressing the apoptosis of HCC cells via downregulation of the expression of pro-apoptotic factors (PMID: 38168642).