ZNF699 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF699 Polyclonal antibody, PBS Only (21562-1-PBS)

• 

  WB analysis of human brain using 21562-1-AP (same clone as 21562-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 21562-1-AP (ZNF699 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21562-1-PBS in a different storage buffer formulation.

ZNF699 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21562-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

hang, Hangover homolog, Zinc finger protein 699

---

Product Information

21562-1-PBS targets ZNF699 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15990

  Product name: Recombinant human ZNF699 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 48-337 aa of BC109268

  Sequence: MLENFQNLASLGYPLHTPHLISQWEQEEDLQTVKRELIQGIFMGEHREGFETQLKTNESVASQDICGEKISNEQKIVRFKRNDSWFSSLHENQESCGIDYQNKSHERHLRNHMVENIYECYEENQDGQTFSQVPNLDSLKRNTEVKSCECHECGKAFVDHSSLKSHIRSHTGSKPYQCKECGKAFHFLACFKKHMKTPTEEKPYECKECTKAFSCSSFFRAHMKIHIGKTNYECKECGKGFSCSSSLTEHKRIHSGDKPYECKECGKAFSCSSSLSKHKRIHSGDKPYEC

• Full Name: zinc finger protein 699
• Calculated Molecular Weight: 642 aa, 74 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC109268
• Gene Symbol: ZNF699
• Gene ID (NCBI): 374879
• RRID: AB_10733885
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q32M78
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.