ZNF703 Polyclonal antibody

• 

  WB analysis of Jurkat using 21075-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 21075-1-AP (ZNF703 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse spleen using 21075-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 21075-1-AP (ZNF703 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 21075-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 21075-1-AP (ZNF703 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 21075-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 21075-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse intestine using 21075-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse intestine tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human malignant melanoma using 21075-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 21075-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 21075-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat cerebellum using 21075-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat skin using 21075-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skin tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat small intestine using 21075-1-AP

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ZNF703 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21075-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ZPO1, ZNF503L, Zinc finger elbow-related proline domain protein 1, ZEPPO1

---

Tested Applications

• Positive WB detected in: Jurkat cells, human brain tissue, mouse spleen tissue
• Positive IHC detected in: human breast cancer tissue, human malignant melanoma tissue, mouse cerebellum tissue, mouse intestine, mouse skin tissue, rat cerebellum tissue, rat skin tissue, rat small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

21075-1-AP targets ZNF703 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15242

  Product name: Recombinant human ZNF703 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 241-590 aa of BC032534

  Sequence: ELDKKDQEPKPSPEPAAVSRGGGGEPGAHGGAESGASGRKSEPPSALVGAGHVAPVSPYKPGHSVFPLPPSSIGYHGSIVGAYAGYPSQFVPGLDPSKSGLVGGQLSGGLGLPPGKPPSSSPLTGASPPSFLQGLCRDPYCLGGYHGASHLGGSSCSTCSAHDPAGPSLKAGGYPLVYPGHPLQPAALSSSAAQAALPGHPLYTYGFMLQNEPLPHSCNWVAASGPCDKRFATSEELLSHLRTHTALPGAEKLLAAYPGASGLGSAAAAAAAAASCHLHLPPPAAPGSPGSLSLRNPHTLGLSRYHPYGKSHLSTAGGLAVPSLPTAGPYYSPYALYGQRLASASALGYQ

• Full Name: zinc finger protein 703
• Calculated Molecular Weight: 590 aa, 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC032534
• Gene Symbol: ZNF703
• Gene ID (NCBI): 80139
• RRID: AB_10732687
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H7S9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Dis; Long noncoding RNA AFAP1-AS1 promotes tumor progression and invasion by regulating the miR-2110/Sp1 axis in triple-negative breast cancer.; Authors - Xiaohui Zhang