ZNF706 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF706 Polyclonal antibody (32274-1-AP)

• 

  WB analysis of A431 using 32274-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 32274-1-AP (ZNF706 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

ZNF706 Polyclonal Antibody for WB, ELISA

Cat No. 32274-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

HSPC038, PNAS-113, Zinc finger protein 706

---

Tested Applications

• Positive WB detected in: A431 cells, HepG2 cells, SMMC-7221 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32274-1-AP targets ZNF706 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37605

  Product name: Recombinant human ZNF706 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-76 aa of BC015925

  Sequence: MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQA

• Full Name: zinc finger protein 706
• Calculated Molecular Weight: 76 aa, 8 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC015925
• Gene Symbol: ZNF706
• Gene ID (NCBI): 51123
• RRID: AB_3742562
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y5V0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Zinc Finger domains account for 5% of all human proteins and interact with various substrates, such as lipids, DNA, RNA, and post-translational modifications. In addition, zinc finger proteins (ZNFs) are involved in transcriptional regulation, signal transduction, and other cellular processes. Zinc finger protein 706 (ZNF706), encoded by a gene located at chromosome 8q22.3, is a member of the C2H2-type zinc finger transcription factor family, the most abundant transcription factor family encoded by the human genome. And according to the structural analysis of ZNF706, it was definitely predicted to physically bind to DNA through the C-terminal zinc finger domain. In previous studies, it was reported that the expression of ZNF706 is upregulated in gastric cancer and laryngeal cancer. And ZNF706 may be a biomarker for the early diagnosis of rheumatoid arthritis. ZNF706 is a potential oncogene in liver cancer and functions as a ferroptosis regulator by modulating SLC7A11 expression, constituting a potential therapeutic target for HCC (PMID: 38862581).