Filter:
Tested Applications
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22074-1-AP targets ZNF718 in IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17216 Product name: Recombinant human ZNF718 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 311-431 aa of BC104027 Sequence: FSCEECGNVFTTSSDFAKHKRIHTGEKPYKCEECGKSFNRSTTLTTHKRIHTGEKPYTCEECGKAFNWSSTLNVHKRIHSGKNPYKCEDCGKAFKVFANLHNHKKIHTGEKPYICKQCGKA Predict reactive species |
| Full Name | zinc finger protein 718 |
| Calculated Molecular Weight | 478 aa, 55 kDa |
| GenBank Accession Number | BC104027 |
| Gene Symbol | ZNF718 |
| Gene ID (NCBI) | 255403 |
| RRID | AB_3742065 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q3SXZ3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ZNF718 (Zinc Finger Protein 718) is a member of the Krueppel C2H2-type zinc‑finger protein family, a large class of transcription factors characterized by tandem C2H2 zinc‑finger motifs that mediate sequence‑specific DNA binding.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ZNF718 antibody 22074-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
