ZNF74 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF74 Polyclonal antibody (21843-1-AP)

ZNF74 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 21843-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Cos52, hZNF7, Zfp520, zinc finger protein 74, ZNF520, ZNF74

• 

  WB analysis of Jurkat using 21843-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 21843-1-AP (ZNF74 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 21843-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 21843-1-AP (ZNF74 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 21843-1-AP

  Immunofluorescent analysis of HepG2 cells, using ZNF74 antibody 21843-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ZNF74 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, human brain tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21843-1-AP targets ZNF74 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13581

  Product name: Recombinant human ZNF74 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 464-644 aa of BC013395

  Sequence: RIHSGEKPFKCNECGKAFSSHAYLIVHRRIHTGEKPFDCSQCWKAFSCHSSLIVHQRIHTGEKPYKCSECGRAFSQNHCLIKHQKIHSGEKSFKCEKCGEMFNWSSHLTEHQRLHSEGKPLAIQFNKHLLSTYYVPGSLLGAGDAGLRDVDPIDALDVAKLLCVVPPRAGRNFSLGSKPRN

• Full Name: zinc finger protein 74
• Calculated Molecular Weight: 644 aa, 72 kDa
• Observed Molecular Weight: 64-72 kDa
• GenBank Accession Number: BC013395
• Gene Symbol: ZNF74
• Gene ID (NCBI): 7625
• RRID: AB_10836937
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16587
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ZNF74 Polyclonal antibody (Cat# 21843-1-AP) has 1 total citation. It appears in Biomolecules (Impact Factor 5.6), a 2023 study investigating how 5'-tRF-19-Q1Q89PJZ suppresses proliferation and metastasis of pancreatic cancer cells via regulating Hexokinase 1-mediated glycolysis. The research field is oncology/metabolic regulation in cancer. The antibody was used for Western Blot in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Biomolecules; 5'-tRF-19-Q1Q89PJZ Suppresses the Proliferation and Metastasis of Pancreatic Cancer Cells via Regulating Hexokinase 1-Mediated Glycolysis; Authors - Wenpeng Cao