ZNF74 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86065-1-RR (same clone as 86065-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86065-1-RR (ZNF74 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86065-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86065-1-RR (same clone as 86065-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86065-1-RR (ZNF74 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86065-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86065-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86065-1-RR against Human ZNF74 were performed. The affinity constant is below 1 pM.

ZNF74 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86065-1-PBS

Clone No.250627F12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Cos52, hZNF7, Zfp520, Zinc finger protein 520, Zinc finger protein 74

---

Product Information

86065-1-PBS targets ZNF74 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13580

  Product name: Recombinant human ZNF74 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 464-644 aa of BC013395

  Sequence: RIHSGEKPFKCNECGKAFSSHAYLIVHRRIHTGEKPFDCSQCWKAFSCHSSLIVHQRIHTGEKPYKCSECGRAFSQNHCLIKHQKIHSGEKSFKCEKCGEMFNWSSHLTEHQRLHSEGKPLAIQFNKHLLSTYYVPGSLLGAGDAGLRDVDPIDALDVAKLLCVVPPRAGRNFSLGSKPRN

• Full Name: zinc finger protein 74
• Calculated Molecular Weight: 644 aa, 72 kDa
• Observed Molecular Weight: 64-72 kDa
• GenBank Accession Number: BC013395
• Gene Symbol: ZNF74
• Gene ID (NCBI): 7625
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16587
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.