ZNF747 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF747 Polyclonal antibody, PBS Only (19901-1-PBS)

• 

  WB analysis of PC-3 using 19901-1-AP (same clone as 19901-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 19901-1-AP (ZNF747 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19901-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 19901-1-AP (same clone as 19901-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 19901-1-AP (ZNF747 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 19901-1-PBS in a different storage buffer formulation.

ZNF747 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 19901-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

19901-1-PBS targets ZNF747 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13821

  Product name: Recombinant human ZNF747 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-191 aa of BC001361

  Sequence: MTDPSLGLTVPMAPPLAPLPPRDPNGAGSEWRKPGAVSFADVAVYFSREEWGCLRPAQRALYRDVMRETYGHLGALGESPTCLPGPCASTGPAAPLGAACGVGGPGAGQAASSQRGVCVLLPQESEAASRRSSPGWRRRPNCGIRLPRIRRWRSVRQKRTQQIPETRKRKDKGKGREPWRSPTLWPPGLLG

• Full Name: zinc finger protein 747
• Calculated Molecular Weight: 191 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC001361
• Gene Symbol: ZNF747
• Gene ID (NCBI): 65988
• RRID: AB_2878620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BV97
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.