ZNF750 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF750 Polyclonal antibody, PBS Only (21752-1-PBS)

ZNF750 Polyclonal Antibody for IHC, IP, ELISA

Cat No. 21752-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IP, ELISA

Synonyms

Protein ZNF750, Zfp750, Zinc finger protein 750

• 

  IP experiment of SiHa using 21752-1-AP (same clone as 21752-1-PBS)

  IP result of anti-ZNF750 (IP:21752-1-AP, 4ug; Detection:21752-1-AP 1:500) with SiHa cells lysate 1520 ug. This data was developed using the same antibody clone with 21752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus cancer using 21752-1-AP (same clone as 21752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 21752-1-AP (ZNF750 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus cancer using 21752-1-AP (same clone as 21752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 21752-1-AP (ZNF750 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 21752-1-AP (same clone as 21752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 21752-1-AP (ZNF750 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 21752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 21752-1-AP (same clone as 21752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 21752-1-AP (ZNF750 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 21752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 21752-1-AP (same clone as 21752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 21752-1-AP (ZNF750 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 21752-1-AP (same clone as 21752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 21752-1-AP (ZNF750 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21752-1-PBS in a different storage buffer formulation.

---

Product Information

21752-1-PBS targets ZNF750 in IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16116

  Product name: Recombinant human ZNF750 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 374-723 aa of BC109037

  Sequence: HVEFESPIPEAKDSSKAGQRDTEGSKMSPRAGSAATGSPGRPSPTDFMQTSQTCEGLYDLSNKAASSALGRLYPPEQSLTAFRPVKKSTECLPAQAAETTAESPVSLNVVNGDPPAPTGSASLVSEAAPSSPDDSSGMGPLNLSKKSEINLAATHEPTYQGSPQAETASFSELQDLPLNLSVKDPCNTQAPRPAFPGRPRAAEPAAAVPQKTGTEGSEDGPSHPETKPGSLDGDGAPPTGPGEEAPDACAVDSSEEQKQTAAVALCQLAAYSPRNIRVGDGDAAAPEPACRQDTPTLSSMESQEAQCDLRPKGQKRTSLRDAGKSQQGAKKAKLQDTARVFTLRRRARVS

• Full Name: zinc finger protein 750
• Calculated Molecular Weight: 723 aa, 77 kDa
• Observed Molecular Weight: 70-77 kDa
• GenBank Accession Number: BC109037
• Gene Symbol: ZNF750
• Gene ID (NCBI): 79755
• RRID: AB_10863125
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q32MQ0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF750 is a novel nuclear protein highly expressed in differentiated skin keratinocytes. Mutation of ZNF750 is linked with familial psoriasis. Recently ZNF was found to be significantly mutated in esophageal squamous cell carcinoma (ESCC). Expression of ZNF750 is decreased in ESCC compared to the normal tissue.