Home
Products
Primary Antibodies
ZNF785 Polyclonal antibody, PBS Only (25588-1-PBS)

Filter: AllWB

WB analysis of HeLa using 25588-1-AP (same clone as 25588-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 25588-1-AP (ZNF785 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25588-1-PBS in a different storage buffer formulation.
WB analysis of A549 using 25588-1-AP (same clone as 25588-1-PBS)
A549 cells were subjected to SDS PAGE followed by western blot with 25588-1-AP (ZNF785 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25588-1-PBS in a different storage buffer formulation.
WB analysis of PC-3 using 25588-1-AP (same clone as 25588-1-PBS)
PC-3 cells were subjected to SDS PAGE followed by western blot with 25588-1-AP (ZNF785 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25588-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 25588-1-AP (same clone as 25588-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 25588-1-AP (ZNF785 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25588-1-PBS in a different storage buffer formulation.
WB analysis of A549 using 25588-1-AP (same clone as 25588-1-PBS)
A549 cells were subjected to SDS PAGE followed by western blot with 25588-1-AP (ZNF785 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25588-1-PBS in a different storage buffer formulation.
WB analysis of HepG2 using 25588-1-AP (same clone as 25588-1-PBS)
HepG2 cells were subjected to SDS PAGE followed by western blot with 25588-1-AP (ZNF785 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25588-1-PBS in a different storage buffer formulation.
WB analysis of HepG2 using 25588-1-AP (same clone as 25588-1-PBS)
HepG2 cells were subjected to SDS PAGE followed by western blot with 25588-1-AP (ZNF785 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25588-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 25588-1-AP (same clone as 25588-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 25588-1-AP (ZNF785 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25588-1-PBS in a different storage buffer formulation.
WB analysis of HepG2 using 25588-1-AP (same clone as 25588-1-PBS)
HepG2 cells were subjected to SDS PAGE followed by western blot with 25588-1-AP (ZNF785 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25588-1-PBS in a different storage buffer formulation.

ZNF785 Polyclonal antibody, PBS Only

Name: ZNF785 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 25588-1-PBS

ZNF785 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25588-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

25588-1-PBS targets ZNF785 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag22291 Product name: Recombinant human ZNF785 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 348-405 aa of BC040642 Sequence: GFKRKTALEAHRWIHRSCSERRAWQQAVVGRSEPIPVLGGKDPPVHFRHFPDIFQECG Predict reactive species
Full Name	zinc finger protein 785
Calculated Molecular Weight	405 aa, 46 kDa
Observed Molecular Weight	48-55 kDa
GenBank Accession Number	BC040642
Gene Symbol	ZNF785
Gene ID (NCBI)	146540
RRID	AB_2880143
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	A8K8V0
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.