ZNF821 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF821 Polyclonal antibody, PBS Only (33351-1-PBS)

• 

  WB analysis using 33351-1-AP (same clone as 33351-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33351-1-AP (ZNF821 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33351-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 33351-1-AP (same clone as 33351-1-PBS)

  WB result of ZNF821 antibody (33351-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-ZNF821 transfected LNCaP cells. This data was developed using the same antibody clone with 33351-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ZNF821 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33351-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Zinc finger protein 821

---

Product Information

33351-1-PBS targets ZNF821 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38977

  Product name: Recombinant human ZNF821 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 200-370 aa of BC012116

  Sequence: AAYRKLLEAQTPSVRKWALRRQNEPLEVRLQRLERERTAKKSRRDNETPEEREVRRMRDREAKRLQRMQETDEQRARRLQRDREAMRLKRANETPEKRQARLIREREAKRLKRRLEKMDMMLRAQFGQDPSAMAALAAEMNFFQLPVSGVELDSQLLGKMAFEEQNSSSLH

• Full Name: zinc finger protein 821
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC012116
• Gene Symbol: ZNF821
• Gene ID (NCBI): 55565
• RRID: AB_3742947
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O75541
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF821, the human protein that contains the STPR domain, is a zinc finger protein of unknown function. The defining structural characteristic of ZNF821 is the presence of two C2H2-type zinc finger motifs . These motifs are small protein domains that fold around a central zinc ion, enabling the protein to interact directly with DNA. (PMID: 20795678)