Filter: AllWB

WB analysis using 33448-1-AP (same clone as 33448-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 33448-1-AP (ZNF85 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33448-1-PBS in a different storage buffer formulation.
WB analysis using 33448-1-AP (same clone as 33448-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 33448-1-AP (ZNF85 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33448-1-PBS in a different storage buffer formulation.

ZNF85 Polyclonal antibody, PBS Only

Name: ZNF85 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 33448-1-PBS

ZNF85 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33448-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Zinc finger protein 85, Zinc finger protein HPF4, Zinc finger protein HTF1

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

33448-1-PBS targets ZNF85 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag38326 Product name: Recombinant human ZNF85 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 60-200 aa of NM_003429.4 Sequence: KEAWSMKRHEIMVAKPTVMCSHFAQDLWPEQNIKDSFQKVTLKRYGKCRHENLPLRKGCESMDECKMHKGGCNGLNQCLTATQSKIFQCDKYVKVAHKFSNSNRHEIRHTKKKPFKCTKCGKSFGMISCLTEHSRIHTRVN Predict reactive species
Full Name	zinc finger protein 85
Calculated Molecular Weight	69kDa，595aa
Observed Molecular Weight	70 kDa
GenBank Accession Number	NM_003429.4
Gene Symbol	ZNF85
Gene ID (NCBI)	7639
RRID	AB_3742974
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity Purification
UNIPROT ID	Q03923
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™