ZNHIT1 Polyclonal antibody

• 

  WB analysis using 16595-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16595-1-AP (ZNHIT1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 16595-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 16595-1-AP (ZNHIT1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 16595-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 16595-1-AP (ZNHIT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 16595-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using ZNHIT1 antibody (16595-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HepG2 using 16595-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using ZNHIT1 antibody (16595-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

ZNHIT1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16595-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Zinc finger HIT domain-containing protein 1, p18 Hamlet, Cyclin-G1-binding protein 1, Cyclin G1 binding protein 1, CGBP1

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, PC-12 cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

16595-1-AP targets ZNHIT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9741

  Product name: Recombinant human ZNHIT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-154 aa of BC017333

  Sequence: MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV

• Full Name: zinc finger, HIT type 1
• Calculated Molecular Weight: 154 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC017333
• Gene Symbol: ZNHIT1
• Gene ID (NCBI): 10467
• RRID: AB_2220382
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43257
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZNHIT1(Zinc finger HIT domain containing protein 1), aslo named CGBP1 (Cyclin G1 binding protein 1), is a subunit of the SNF-2 related CBP activator protein (SRCAP) complex, which can remodel chromatin by incorporating the histone variant H2A.Z into nucleosomes(PMID: 15647280). ZNHIT1 also can bind to myogenin promoter and mediate H2A.Z incorporation for its expression(PMID: 20473270). ZNHIT1 overexpression induces apoptosis and represses proliferation and invasion of breast cancer cells(PMID: 30928405).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; ANP32E is a histone chaperone that removes H2A.Z from chromatin.; Authors - Arnaud Obri
	WB	Cell Discov; Structural insights into histone exchange by human SRCAP complex; Authors - Jiali Yu