ZNHIT3 Polyclonal antibody

• 

ZNHIT3 Polyclonal Antibody for ELISA

Cat No. 11832-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

ELISA

Synonyms

HNF 4a coactivator, TR interacting protein 3, TRIP 3, TRIP3, zinc finger, HIT type 3, ZNHIT3

---

Product Information

11832-1-AP targets ZNHIT3 in ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2405

  Product name: Recombinant human ZNHIT3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-155 aa of BC017931

  Sequence: MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFADCCLGIVEPSQNEES

• Full Name: zinc finger, HIT type 3
• Calculated Molecular Weight: 155 aa, 18 kDa
• GenBank Accession Number: BC017931
• Gene Symbol: ZNHIT3
• Gene ID (NCBI): 9326
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15649
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.