ZNHIT3 Monoclonal antibody, PBS Only

ZNHIT3 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 68331-1-PBS
Clone No.1C7A3

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, IF/ICC, Indirect ELISA

HNF 4a coactivator, TR interacting protein 3, TRIP 3, TRIP3, zinc finger, HIT type 3, ZNHIT3

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68331-1-PBS targets ZNHIT3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29872

Product name: Recombinant human ZNHIT3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-155 aa of BC017931

Sequence: MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFADCCLGIVEPSQNEES

Predict reactive species
Full Name zinc finger, HIT type 3
Calculated Molecular Weight 155 aa, 18 kDa
Observed Molecular Weight18 kDa
GenBank Accession NumberBC017931
Gene Symbol ZNHIT3
Gene ID (NCBI) 9326
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15649
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ZNHIT3, also named TRIP3, belongs to the zinc finger HIT (Zf-HIT) domain-containing proteins family. ZNHIT3 encodes a nuclear zinc finger protein previously implicated in transcriptional regulation and small nucleolar ribonucleoprotein particle assembly and thus possibly to pre-ribosomal RNA processing (PMID: 28335020). ZNHIT3 contains at least two domains: a ZN-HIT domain that consists of a double zinc-finger, probably involved in protein−protein interaction, and a PAC-HIT domain that folds into a clamp able to trap an α-helix, here again of about 20 residues, located in the sequence of NUFIP1 (PMID: 35315277). ZNHIT3 has 2 isoforms produced by alternative splicing.

Loading...
||
New chat Able
正在加载,请稍候...