ZNHIT6 Polyclonal antibody

• 

  WB analysis of mouse lung using 28019-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 28019-1-AP (ZNHIT6 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

ZNHIT6 Polyclonal Antibody for WB, ELISA

Cat No. 28019-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse

Applications

WB, ELISA

Synonyms

Box C/D snoRNA protein 1, C1orf181, FLJ20729, FLJ20760, NY BR 75, zinc finger, HIT type 6, ZNHIT6

---

Tested Applications

• Positive WB detected in: mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28019-1-AP targets ZNHIT6 in WB, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27792

  Product name: Recombinant human ZNHIT6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-203 aa of BC026236

  Sequence: MEFAAENEGKSGGGLHSVAEGVRLSPEPGREGVRDLAGAEEFGGGEEGTGLTGIKEIGDGEEGSGQRPEEIPMDLTVVKQEIIDWPGTEGRLAGQWVEQEVEDRPEVKDENAGVLEVKQETDSSLVVKEAKVGEPEVKEEKVKEEVMDWSEVKEEKDNLEIKQEEKFVGQCIKEELMHGECVKEEKDFLKKEIVDDTKVKEEP

• Full Name: zinc finger, HIT type 6
• Calculated Molecular Weight: 470 aa, 54 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC026236
• Gene Symbol: ZNHIT6
• Gene ID (NCBI): 54680
• RRID: AB_2881037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NWK9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.