• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated ZO-1 Monoclonal antibody

ZO-1 Monoclonal Antibody for IF/ICC
Cat No. CL488-66452
Clone No.1G4A1

Host / Isotype

Mouse / IgG1

Reactivity

human, canine

Applications

IF/ICC

TJP1, ZO 1, Tight junction protein ZO-1, Tight junction protein ZO 1, Tight junction protein 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66452 targets ZO-1 in IF/ICC applications and shows reactivity with human, canine samples.

Tested Reactivity human, canine
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16454

Product name: Recombinant human ZO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1446-1748 aa of BC111712

Sequence: SLHIHSKGAHGEGNSVSLDFQNSLVSKPDPPPSQNKPATFRPPNREDTAQAAFYPQKSFPDKAPVNGTEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAHKPDLSSKTPTSPKTLVKSHSLAQPPEFDSGVETFSIHAEKPKYQINNISTVPKAIPVSPSAVEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF

Predict reactive species
Full Name tight junction protein 1 (zona occludens 1)
Calculated Molecular Weight 1748 aa, 195 kDa
Observed Molecular Weight 230 kDa
GenBank Accession NumberBC111712
Gene Symbol ZO-1
Gene ID (NCBI) 7082
RRIDAB_2919329
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ07157
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Tight junction (or zonula occludens) form the continuous intercellular barrier between epithelial and endothelial cells, which is required to separate tissue spaces and regulate selective movement of solutes across the epithelium and endothelium (PMID: 20066090). ZO-1 (also known as TJP1) is a peripheral membrane phosphoprotein located on the cytoplasmic face and is expressed in tight junctions of both epithelial and endothelial cells (PMID: 3528172). It binds the transmembrane proteins occludin and the claudins linking them to cytoskeletal actin (PMID: 17418867). ZO-1 belongs to a family of multidomain proteins known as the membrane-associated guanylate kinase homologs (MAGUKs). It is a pivotal tight junction protein and may be involved in signalling mechanisms regulating cell proliferation and differentiation (PMID: 22782886).

Loading...
||
New chat

Able

正在加载,请稍候...