ZRSR2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZRSR2 Polyclonal antibody, PBS Only (33753-1-PBS)

• 

  WB analysis using 33753-1-AP (same clone as 33753-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33753-1-AP (ZRSR2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33753-1-PBS in a different storage buffer formulation.

ZRSR2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33753-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Renal carcinoma antigen NY-REN-20, U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2, U2(RNU2) small nuclear RNA auxiliary factor 1-like 2, U2AF1L2, U2AF1RS2

---

Product Information

33753-1-PBS targets ZRSR2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36984

  Product name: Recombinant human ZRSR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 360-482 aa of BC050451

  Sequence: NSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNSRSRGRNRDRSRDRSRGRGSRSRSRSRSCRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSK

• Full Name: zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC050451
• Gene Symbol: ZRSR2
• Gene ID (NCBI): 8233
• RRID: AB_3743067
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q15696
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.