ZSCAN2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZSCAN2 Polyclonal antibody, PBS Only (32581-1-PBS)

• 

  WB analysis using 32581-1-AP (same clone as 32581-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32581-1-AP (ZSCAN2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32581-1-PBS in a different storage buffer formulation.

ZSCAN2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32581-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ZNF854, Zinc finger protein 854, Zinc finger protein 29 homolog, Zinc finger and SCAN domain-containing protein 2, Zfp-29

---

Product Information

32581-1-PBS targets ZSCAN2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38126

  Product name: Recombinant human ZSCAN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC136342

  Sequence: MMAADIPRVTTPLSSLVQVPQEEDRQEEEVTTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVTRGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEEAAALVEDLTQTLQDSDFEIQSENGENCNQDMFENESRKIFSEMPEGESAQHSDGESDFERDAGIQRLQGHTPGEDHGEVV

• Full Name: zinc finger and SCAN domain containing 2
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC136342
• Gene Symbol: ZSCAN2
• Gene ID (NCBI): 54993
• RRID: AB_3742660
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7Z7L9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Zinc finger and SCAN domain-containing protein 2 (ZSCAN2, also known as ZFP29 and ZNF854) plays an important role in the maintenance of the SSC (spermatogonial stem cells) pool in vitro and is integral for robust regeneration of spermatogenesis in vivo following exposure to clastogens. Loss of ZSCAN2 expression alters key cellular processes in undifferentiated spermatogonia, such as translation, chromatin modification, and ubiquitin conjugation (PMID: 35244684).