ZSCAN21 Polyclonal antibody

• 

  WB analysis of HEK-293 using 23164-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 23164-1-AP (ZSCAN21 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 23164-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 23164-1-AP (ZSCAN21 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

ZSCAN21 Polyclonal Antibody for WB, ELISA

Cat No. 23164-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

NY REN 21, Zfp 38, ZFP38, Zinc finger protein 38 homolog, Zipro1, ZNF38, ZSCAN21

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23164-1-AP targets ZSCAN21 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19595

  Product name: Recombinant human ZSCAN21 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 131-282 aa of BC047309

  Sequence: GHQVSTPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDIISVIIANKPEASLERQCVNLENEKGTKPPLQEAGSKKGRESVPTKPTPGERRYICAEC

• Full Name: zinc finger and SCAN domain containing 21
• Calculated Molecular Weight: 473 aa, 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC047309
• Gene Symbol: ZSCAN21
• Gene ID (NCBI): 7589
• RRID: AB_2879220
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5A6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.