ZWILCH Polyclonal antibody

• 

  WB analysis of PC-3 using 14281-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 14281-1-AP (ZWILCH Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 14281-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14281-1-AP (ZWILCH antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ZWILCH Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14281-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Protein zwilch homolog, KNTC1AP, hZwilch

---

Tested Applications

• Positive WB detected in: PC-3 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

14281-1-AP targets ZWILCH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5454

  Product name: Recombinant human ZWILCH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 179-477 aa of BC036900

  Sequence: KSAVELVQEFLNDLNKLDGFGDSTKKDTEVETLKHDTAAVDRSVKRLFKVRSDLDFAEQLWCKMSSSVISYQDLVKCFTLIIQSLQRGDIQPWLHSGSNSLLSKLIHQSYHGTMDTVSLSGTIPVQMLLEIGLDKLKKDYISFFIGQELASLNHLEYFIAPSVDIQEQVYRVQKLHHILEILVSCMPFIKSQHELLFSLTQICIKYYKQNPLDEQHIFQLPVRPTAVKNLYQSEKPQKWRVEIYSGQKKIKTVWQLSDSSPIDHLNFHKPDFSELTLNGSLEERIFFTNMVTCSQVHFK

• Full Name: Zwilch, kinetochore associated, homolog (Drosophila)
• Calculated Molecular Weight: 67 kDa
• Observed Molecular Weight: ~60 kDa
• GenBank Accession Number: BC036900
• Gene Symbol: ZWILCH
• Gene ID (NCBI): 55055
• RRID: AB_2878040
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H900
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZWILCH is a new component of the ZW10/ROD complex. The complex is a key player in the spindle checkpoint. ZWILCH has two isoforms with MW 67 kDa and 54 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Nucleic Acids Res; ULK1 phosphorylates Mad1 to regulate spindle assembly checkpoint.; Authors - Fengjie Yuan
human	IHC	Biomedicines; The Enhanced Expression of ZWILCH Predicts Poor Survival of Adrenocortical Carcinoma Patients; Authors - Małgorzata Blatkiewicz