ZYG11A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZYG11A Polyclonal antibody, PBS Only (30597-1-PBS)

• 

  WB analysis of HeLa using 30597-1-AP (same clone as 30597-1-PBS)

  WB result of ZYG11A antibody (30597-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ZYG11A transfected HeLa cells. This data was developed using the same antibody clone with 30597-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30597-1-AP (same clone as 30597-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30597-1-AP (ZYG11A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30597-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30597-1-AP (same clone as 30597-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30597-1-AP (ZYG11A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30597-1-PBS in a different storage buffer formulation.

• 

  IF Staining of K-562 using 30597-1-AP (same clone as 30597-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using ZYG11A antibody (30597-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 30597-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ZYG11A Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 30597-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Protein zyg 11 homolog A, ZYG11

---

Product Information

30597-1-PBS targets ZYG11A in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30166

  Product name: Recombinant human ZYG11A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 628-696 aa of NM_001004339

  Sequence: TSDRQLWISRDFQRRTLLQDLHATIQNWPSSSCKMTALVTYRSFKTFFPLLGNFSQPEVQLWALWAMYH

• Full Name: zyg-11 homolog A (C. elegans)
• Calculated Molecular Weight: 86 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: NM_001004339
• Gene Symbol: ZYG11A
• Gene ID (NCBI): 440590
• RRID: AB_3742356
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6WRX3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZYG11A is a member of the Zyg11 protein family that functions as a target recruitment subunit of an E3 ubiquitin ligase complex playing a central role in the degradation of a regulatory protein involved in cell cycle regulation. ZYG11A is over-expressed in NSCLC tumor tissues and correlates with more aggressive clinical characteristics. Also ZYG11A gene constitutes a novel target for IGF1 action in endometrial cancer cells (PMID: 26771237, 31320996). This antibody is specific to isoform 2 of ZYG11A with a predicted molecular mass of 48 kDa.