Znt5 Polyclonal antibody

• 

  IP experiment of mouse liver using 25604-1-AP

  IP result of anti-Znt5 (IP:25604-1-AP, 4ug; Detection:25604-1-AP 1:500) with mouse liver tissue lysate 4000ug.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 25604-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 25604-1-AP (Znt5 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

Znt5 Polyclonal Antibody for IHC, IP, ELISA

Cat No. 25604-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IP, ELISA

Synonyms

SLC30A5, hZTL1, Proton-coupled zinc antiporter SLC30A5, UNQ863/PRO1879, ZnT 5

---

Tested Applications

• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 5 publications below

Product Information

25604-1-AP targets Znt5 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12947

  Product name: Recombinant human SLC30A5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-118 aa of BC000808

  Sequence: MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIVQFIFILKLGTAFFMVLFQKPFSSGKTITKHQIIGSLKIPGRKEFKDKKLNDPRKLVGN

• Full Name: solute carrier family 30 (zinc transporter), member 5
• Calculated Molecular Weight: 84 kDa
• Observed Molecular Weight: 84-87 kDa
• GenBank Accession Number: BC000808
• Gene Symbol: Znt5
• Gene ID (NCBI): 64924
• RRID: AB_2880155
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TAD4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Cancer; Integrated pan-cancer genomic analysis reveals the role of SLC30A5 in the proliferation, metastasis, and prognosis of hepatocellular carcinoma; Authors - Yihan Liu ; KD Validated
chicken	WB	Front Physiol; Organic zinc with moderate chelation strength enhances zinc absorption in the small intestine and expression of related transporters in the duodenum of broilers; Authors - Yun Hu
chicken	WB	J Anim Sci; Zinc proteinate with moderate chelation strength enhances zinc absorption by upregulating the expression of zinc and amino acid transporters in primary cultured duodenal epithelial cells of broiler embryos; Authors - Yun Hu
chicken	WB	Poult Sci; The organic zinc with moderate chelation strength enhances the expression of related transporters in the jejunum and ileum of broilers; Authors - Yun Hu
	WB	Biochim Biophys Acta Gene Regul Mech; Transcriptional regulation of Znt family members znt4, znt5 and znt10 and their function in zinc transport in yellow catfish (Pelteobagrus fulvidraco); Authors - Lu-Lu Liu ; KD Validated