Beta Arrestin 1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• Beta Arrestin 1 Monoclonal antibody (67580-1-Ig)

• 

  WB analysis using 67580-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67580-1-Ig (Arrestin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 67580-1-Ig

  WB result of Beta Arrestin 1 antibody (67580-1-Ig; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Beta Arrestin 1 transfected HepG2 cells.

• 

  WB analysis of NIH/3T3 using 67580-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67580-1-Ig (Arrestin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human peripheral blood platelets using 67580-1-Ig

  Human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 67580-1-Ig (Arrestin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 67580-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67580-1-Ig (Arrestin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 67580-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67580-1-Ig (Beta Arrestin 1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

Beta Arrestin 1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67580-1-Ig

Clone No.1H8E4

Publications(4)

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

ARRB1, ARR1, ARR 1, ARB2, ARB1

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, NIH/3T3 cells, human peripheral blood platelets, K-562 cells, Jurkat cells, HSC-T6 cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 3 publications below
• IP: See 1 publications below

Product Information

67580-1-Ig targets Beta Arrestin 1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7504

  Product name: Recombinant human Arrestin protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 69-418 aa of BC003636

  Sequence: DVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR

• Full Name: arrestin, beta 1
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: BC003636
• Gene Symbol: Beta Arrestin 1
• Gene ID (NCBI): 408
• RRID: AB_2882791
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49407
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

β-Arrestins (ARRBs), the best known regulators of G protein-coupled receptor signaling, are versatile and multifunctional adapter proteins that regulate diverse cellular functions, including cell growth, apoptosis and immune responses. Overexpression of beta Arrestin 1 has been found in various cancers, indicating it as a potential therapeutic target for cancer treatment. Recently expression of ARRB1 in saliva has been identified as a candidate circadian biomarker. ARRB1 migrated as a doublet of two bands of 45 and 55 kDa (PMID:28947386).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IP	Cell Rep Med; Analysis of GRK2 aggregation in the pathology of Alzheimer disease in animal models.; Authors - Joshua Abd Alla
mouse	WB	Acta Pharm Sin B; Free fatty acid receptor-4 regulates T-cell-mediated allogeneic reaction through activating an aryl hydrocarbon receptor pathway; Authors - Maxwell Duah
human	WB	Cell Chem Biol; Cytoplasmic tail diversity determines the effector bias of the adhesion GPCR ADGRL2.; Authors - Krassimira A. Garbett ; KO Validated
human	WB	bioRxiv; Cytoplasmic tail composition modulates the G protein and arrestin-3 signaling bias of the adhesion GPCR LPHN2; Authors - Krassimira Garbett ; KO Validated