Tested Applications
| Positive WB detected in | RAW 264.7 cells, NIH/3T3 cells, Sp2/0 cells |
| Positive IHC detected in | human lung tissue, human placenta tissue, mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29958-1-AP targets cGAS in WB, IHC, IF/ICC, ELISA, CUT&RUN applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31677 Product name: Recombinant mouse cGAS protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 350-507 aa of BC145651 Sequence: KNAKDGNSFQGETWRLSFSHTEKYILNNHGIEKTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLRTEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFDKL Predict reactive species |
| Full Name | RIKEN cDNA E330016A19 gene |
| Calculated Molecular Weight | 58 kDa |
| Observed Molecular Weight | 58 kDa |
| GenBank Accession Number | BC145651 |
| Gene Symbol | cGAS |
| Gene ID (NCBI) | 214763 |
| RRID | AB_2935491 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8C6L5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
cGAS (cyclic GMP-AMP synthase) is a cytosolic DNA sensor that serves to mount an immune response against the invasion of microbial pathogens such as viruses. cGAS normally resides as an inactive protein in the cell. Upon binding to DNA, cGAS undergoes a conformational change to an active state and produces the second messenger cyclic GMP-AMP (cGAMP) from ATP and GTP, which is subsequently detected by the cyclic-dinucleotide sensor STING, an ~40 kDa dimeric transmembrane protein at the endoplasmic reticulum (ER). cGAS not only is found in the cytosol but has a multifaceted cellular distribution that involves localization at the cell membrane and in the nucleus (PMID: 32424334). The calculated molecular weight of cGAS is 58 kDa. With post-translational modification, the MW of cGAS will be migrated to 70 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for cGAS antibody 29958-1-AP | Download protocol |
| IHC protocol for cGAS antibody 29958-1-AP | Download protocol |
| WB protocol for cGAS antibody 29958-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
29958-1-AP is a STING antibody with 78 total citations. It appears in high-impact journals including Nature Communications, Advanced Science, Cancer Research, Biomaterials, Acta Biomaterialia, and Cell Reports, among 60+ others. Research fields span cGAS-STING signaling, inflammation, cancer immunotherapy, neurodegeneration, liver and kidney disease, cardiovascular injury, nanomedicine, and autoimmune disorders. Applications are predominantly Western blot, with IHC and IF also represented.
| Species | Application | Title |
|---|---|---|
Exploration (Beijing) Specifically Breaking Through the Injured Blood-Brain Barrier With Tannic Acid-Based Nanomedicine for Ischemic Stroke Ischemia Reperfusion Treatment. | ||
Adv Mater Fully Biocompatible Tantalum-Based Antioxidant Nanoshields for Proximal Tubule Epithelial Cells-Targeted Mitochondrial Holistic Protection in Acute Kidney Injury. | ||
Bioact Mater Polydopamine as a biocompatible and precise mitochondrial targeted therapeutic platform for reversing myocardial ischemia-reperfusion injury. | ||
Cancer Res An Immune Subtype Classification System Enables the Development of Strategies to Predict and Enhance Immunotherapy Responses in Colorectal Cancer | ||
Nat Commun Macrophage STING signaling promotes fibrosis in benign airway stenosis via an IL6-STAT3 pathway | ||
J Adv Res TRPM2-mediated feed-forward loop promotes chondrocyte damage in osteoarthritis via calcium-cGAS-STING-NF-κB pathway |
Reviews
What customers say
The single review for this product is highly positive, rated 5 stars. The customer used it for Western Blot at a 1:1000 dilution on HeLa cells and described it as a "good antibody," indicating reliable performance for their application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Arnaud (Verified Customer) (08-04-2026) | Good antibody
|
