hCG Alpha Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85800-9-RR (same clone as 85800-9-PBS)

  Hydroxyurea treated JAR cells were subjected to SDS PAGE followed by western blot with 85800-9-RR (CGA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85800-9-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 85800-9-RR (same clone as 85800-9-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 85800-9-RR (CGA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85800-9-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 85800-9-RR (same clone as 85800-9-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 85800-9-RR (CGA antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85800-9-PBS in a different storage buffer formulation.

• 

  IF Staining of JAR using 85800-9-RR (same clone as 85800-9-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Hydroxyurea treated JAR cells using hCG Alpha antibody (85800-9-RR, Clone: 250136C4 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85800-9-PBS in a different storage buffer formulation.

hCG Alpha Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 85800-9-PBS

Clone No.250136C4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CGA, HCG, Anterior pituitary glycoprotein hormones common subunit alpha, CG ALPHA, CG-alpha

---

Product Information

85800-9-PBS targets hCG Alpha in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3377

  Product name: Recombinant Human hCG Alpha protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 25-116 aa of

  Sequence: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

• Full Name: hCG Alpha
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 20 kDa
• Gene ID (NCBI): 1082
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P0DN86(CGB)+P01215(CGA)
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Human chorionic gonadotropin (hCG) is a heterodimeric glycoprotein hormone consisting of two non-covalently linked subunits: a common α-subunit (hCGα) and a hormone-specific β-subunit (hCGβ). The α-subunit, also designated CGA (chorionic gonadotropin alpha chain), is a 92-amino-acid glycopeptide of ~14-22 kDa that is identical to the α-subunits of the pituitary glycoprotein hormones luteinizing hormone (LH), follicle-stimulating hormone (FSH), and thyroid-stimulating hormone (TSH). Because the α-subunit is shared among these hormones, its biological specificity is conferred by the unique β-subunit with which it associates.