IL-33 Polyclonal antibody

IL-33 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 28035-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, ELISA

Il33, Il 33, Il1f11, interleukin 33, NF HEV

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse lung tissue, mouse colon tissue, rat lung tissue
Positive IHC detected inmouse spleen tissue, mouse lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28035-1-AP targets IL-33 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27846

Product name: Recombinant mouse IL-33 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 109-266 aa of NM_001164724

Sequence: MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Predict reactive species
Full Name interleukin 33
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 30-35 kDa
GenBank Accession NumberNM_001164724
Gene Symbol IL-33
Gene ID (NCBI) 77125
RRIDAB_2881042
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8BVZ5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-33 (IL-33) is a tissue-derived nuclear cytokine from the IL-1 family abundantly expressed in endothelial cells, epithelial cells and fibroblast-like cells, both during homeostasis and inflammation. IL-33 activates many immune cell types involved in type-2 immunity and allergic inflammation, including ILC2s, mast cells, Th2 cells, eosinophils, basophils, dendritic cells and alternatively activated macrophages (AAM). As a cytokine, IL-33 interacts with the receptors ST2 (also known as IL1RL1) and IL-1 Receptor Accessory Protein (IL1RAP), activating intracellular molecules in the NF-κB and MAP kinase signaling pathways that drive production of type 2 cytokines (e.g. IL-5 and IL-13) from polarized Th2 cells. IL-33 is also effective in reversing Alzheimer-like symptoms in APP/PS1 mice, by reversing the buildup and preventing the new formation of amyloid plaques. IL-33 is synthesized as a 30-34 kD full-length form and 20 kDa form mature form.

Protocols

Product Specific Protocols
IHC protocol for IL-33 antibody 28035-1-APDownload protocol
WB protocol for IL-33 antibody 28035-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...