Ki-67 Polyclonal antibody

Ki67 antibodies are widely used as markers for cell proliferation, enabling the detection and quantification of actively dividing cells in tissue samples for research and diagnostic applications, especially in cancer pathology. Proteintech has an extensive range of Ki-67 antibodies validated for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA, Cell treatment and more.

Cat No. 28074-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse and More (1)

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA, Cell treatment

Ki 67, ki67, Mki67, Proliferation related Ki 67 antigen

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse colon tissue, mouse spleen tissue
Positive IF-Fro detected inmouse spleen tissue, mouse liver tissue
Positive IF/ICC detected inNIH/3T3 cells
Positive FC (Intra) detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:1500-1:6000
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28074-1-AP targets Ki-67 in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA, Cell treatment applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Cited Reactivitymouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27894

Product name: Recombinant mouse ki67 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2777-3005 aa of NM_001081117

Sequence: MFQSSPRRPRTRRGKVEADEEPSAVRKTVSTSRQTMRSRKVPEIGNNGTQVSKASIKQTLDTVAKVTGSRRQLRTHKDGVQPLEVLGDSKEITQISDHSEKLAHDTSILKSTQQQKPDSVKPLRTCRRVLRASKEDPKEVLVDTRDHATLQSKSNPLLSPKRKSARDGSIVRTRALRSLAPKQEATDEKPVPEKKRAASSKRHVSPEPVKMKHLKIVSNKLESVEEQVST

Predict reactive species
Full Name antigen identified by monoclonal antibody Ki 67
Calculated Molecular Weight 351 kDa
GenBank Accession NumberNM_001081117
Gene Symbol ki67
Gene ID (NCBI) 17345
RRIDAB_2918145
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDE9PVX6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The Ki-67 protein (also known as MKI67) is a cellular marker for proliferation. Ki67 is present during all active phases of the cell cycle (G1, S, G2 and M), but is absent in resting cells (G0). Cellular content of Ki-67 protein markedly increases during cell progression through S phase of the cell cycle. Therefore, the nuclear expression of Ki67 can be evaluated to assess tumor proliferation by immunohistochemistry.

Protocols

Product Specific Protocols
FC protocol for Ki-67 antibody 28074-1-APDownload protocol
IF protocol for Ki-67 antibody 28074-1-APDownload protocol
IHC protocol for Ki-67 antibody 28074-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Drug Resist Updat

Lansoprazole (LPZ) reverses multidrug resistance (MDR) in cancer through impeding ATP-binding cassette (ABC) transporter-mediated chemotherapeutic drug efflux and lysosomal sequestration

Authors - Ning Ji

Cell Mol Immunol

Targeting PHGDH reverses the immunosuppressive phenotype of tumor-associated macrophages through α-ketoglutarate and mTORC1 signaling

Authors - Zhengnan Cai
IF

Bioact Mater

Biomimetic gender-specific human skin model based on gonads/epidermis-on-a-chip

Authors - Xiangyi Wu

Neuron

C5aR1+ microglia exacerbate neuroinflammation and cerebral edema in acute brain injury

Authors - Jinpeng Zhou
mouseIF

Biosens Bioelectron

3D co-culture of macrophages and fibroblasts in a sessile drop array for unveiling the role of macrophages in skin wound-healing

Authors - Xiaoyan Lyu
mouseIHC

Adv Healthc Mater

A Multifunctional Nanodrug Increases the Therapeutic Sensitivity of Lenvatinib to Hepatocellular Carcinoma by Inhibiting the Stemness of Hepatic Cancer Stem Cells

Authors - Xieqing Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kamal (Verified Customer) (01-22-2026)

Antibody was diluted 1:200 in 1X PBS.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200 (IFC)
  • Cell Tissue Type: Bone marrow cells
FH

YINGJIAN (Verified Customer) (11-15-2025)

The antibody produced clear signals with negligible background and high target specificity.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: IHC (paraffin):1:1000
  • Cell Tissue Type: liver
Ki-67 Antibody Immunohistochemistry validation (IHC (paraffin):1:1000 dilution) in liver (Cat no:28074-1-AP)
FH

Ruchi (Verified Customer) (06-08-2023)

Stained Ki67 on murine diabetic skin

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: Mouse skin
Ki-67 Antibody Immunofluorescence validation (1:50 dilution) in Mouse skin (Cat no:28074-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...