Use Able AI chat for product recommendations

CoraLite® Plus 647-conjugated Ki-67 Polyclonal antibody

Ki67 antibodies are widely used as markers for cell proliferation, enabling the detection and quantification of actively dividing cells in tissue samples for research and diagnostic applications, especially in cancer pathology. Proteintech has an extensive range of Ki-67 antibodies validated for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA, Cell treatment and more.

Cat No. CL647-28074

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IHC, IF/ICC, IF-P, FC (Intra)

Mki67, ki67, Ki 67, Proliferation related Ki 67 antigen

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse colon tissue
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inNIH/3T3 cells, Jurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 1 publications below

Product Information

CL647-28074 targets Ki-67 in IHC, IF/ICC, IF-P, FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27894

Product name: Recombinant mouse ki67 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2777-3005 aa of NM_001081117

Sequence: MFQSSPRRPRTRRGKVEADEEPSAVRKTVSTSRQTMRSRKVPEIGNNGTQVSKASIKQTLDTVAKVTGSRRQLRTHKDGVQPLEVLGDSKEITQISDHSEKLAHDTSILKSTQQQKPDSVKPLRTCRRVLRASKEDPKEVLVDTRDHATLQSKSNPLLSPKRKSARDGSIVRTRALRSLAPKQEATDEKPVPEKKRAASSKRHVSPEPVKMKHLKIVSNKLESVEEQVST

Predict reactive species
Full Name antigen identified by monoclonal antibody Ki 67
Calculated Molecular Weight 351 kDa
GenBank Accession NumberNM_001081117
Gene Symbol ki67
Gene ID (NCBI) 17345
RRIDAB_3673572
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDE9PVX6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The Ki-67 protein (also known as MKI67) is a cellular marker for proliferation. Ki67 is present during all active phases of the cell cycle (G1, S, G2 and M), but is absent in resting cells (G0). Cellular content of Ki-67 protein markedly increases during cell progression through S phase of the cell cycle. Therefore, the nuclear expression of Ki67 can be evaluated to assess tumor proliferation by immunohistochemistry.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 Ki-67 antibody CL647-28074Download protocol
IF protocol for CL Plus 647 Ki-67 antibody CL647-28074Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Life Sci

The Bcl-2 family protein NOXA is a novel regulator of liver regeneration.

Authors - Hui Liu
Loading...
||
New chat

Able

正在加载,请稍候...