lama3 Monoclonal antibody, PBS Only (Capture)

lama3 Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 60613-3-PBS
Clone No.1D2D8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

LAMNA, Laminin subunit alpha 3, lama3a, E170, BM600

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60613-3-PBS targets lama3 as part of a matched antibody pair:

MP50873-2: 60613-3-PBS capture and 60613-1-PBS detection (validated in Cytometric bead array)

MP50873-3: 60613-3-PBS capture and 60613-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30144

Product name: Recombinant human lama3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1972-2110 aa of NM_198129

Sequence: EAQRMMRELRNRNFGKHLREAEADKRESQLLLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYEK

Predict reactive species
Full Name laminin, alpha 3
Calculated Molecular Weight 367 kDa
GenBank Accession NumberNM_198129
Gene Symbol LAMA3
Gene ID (NCBI) 3909
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G Magarose purification
UNIPROT IDQ16787
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...