Tested Applications
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-20624 targets mDia1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, monkey samples.
| Tested Reactivity | human, mouse, rat, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14523 Product name: Recombinant human DIAP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1211-1272 aa of BC007411 Sequence: AFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTILEEAKELVGRAS Predict reactive species |
| Full Name | diaphanous homolog 1 (Drosophila) |
| Calculated Molecular Weight | 1272 aa, 141 kDa |
| Observed Molecular Weight | 140-150 kDa, 70 kDa |
| GenBank Accession Number | BC007411 |
| Gene Symbol | mDia1 |
| Gene ID (NCBI) | 1729 |
| RRID | AB_3084036 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60610 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
mDia1, also known as DIAPH1 or Diap1, is a mammalian diaphanous-related formin which is implicated in multiple physical and pathological events including cytoskeletal dynamics, autosomal hearing loss, and myelodysplasia. Depending upon the cell type and position in the cell cycle, mDia1 has been shown to localize to the cell cortex, trafficking endosomes, cleavage furrow, mid-bodies, and centrosomes, the cytoplasmic microtubule-organizing center crucial for cell division. Mutation of mDia1 has been linked to microcephaly. This antibody recognizes the endogenous mDia1 mainly around 140-150 kDa, while sometimes an additional 70 kDa can also be observed which is proposed to be a fragment of 140-150 kDa molecules (26011179).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 mDia1 antibody CL488-20624 | Download protocol |
| IF protocol for CL Plus 488 mDia1 antibody CL488-20624 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



