• Featured Product
  • KD/KO Validated

p115, USO1 Monoclonal antibody

p115, USO1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 68100-1-Ig
Clone No.3B7D8

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

USO1, 3B7D8, General vesicular transport factor p115, Protein USO1 homolog, TAP

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68100-1-Ig targets p115, USO1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5543

Product name: Recombinant human p115, USO1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 660-961 aa of BC032654

Sequence: EQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLDHI

Predict reactive species
Full Name USO1 homolog, vesicle docking protein (yeast)
Calculated Molecular Weight 962 aa, 108 kDa
Observed Molecular Weight108 kDa
GenBank Accession NumberBC032654
Gene Symbol USO1
Gene ID (NCBI) 8615
RRIDAB_2918835
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO60763
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

p115, also known as USO1, TAP (transcytosis-associated protein) or VDP (vesicle docking protein) is a general vesicular transport factor and plays an important role at different steps of vesicular transport. It is a 962-residue peripheral membrane protein which recycles between the cytosol and the Golgi apparatus during interphase (PMID: 9478999). p115 forms stable homodimers (PMID: 19247479). Rab1 recruits p115 to coat protein complex II (COPII) vesicles during budding from the endoplasmic reticulum, where p115 interacts directly with a select set of SNARE proteins (PMID: 10903204). p115 is required for intra-Golgi transport, and also functions in endoplasmic reticulum to Golgi trafficking, Golgi biogenesis and exocytotic transport (PMID: 19247479).

Protocols

Product Specific Protocols
WB protocol for p115, USO1 antibody 68100-1-IgDownload protocol
IHC protocol for p115, USO1 antibody 68100-1-IgDownload protocol
IF protocol for p115, USO1 antibody 68100-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...