p120 Catenin Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• p120 Catenin Recombinant monoclonal antibody (88083-1-RR)

p120 Catenin Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 88083-1-RR

Clone No.260247D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CTNND1, Cadherin-associated Src substrate, CAS, Catenin delta 1, Catenin delta-1

• 

  WB analysis using 88083-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88083-1-RR (CTNND1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. Low expression: HL-60 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 88083-1-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 88083-1-RR (p120 Catenin antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 88083-1-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 88083-1-RR (p120 Catenin antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HT-29 cells, HeLa cells, HEK-293 cells, MDA-MB-231 cells, NIH/3T3 cells, C6 cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88083-1-RR targets p120 Catenin in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2824

  Product name: Recombinant human CTNND1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 546-830 aa of BC010501

  Sequence: GYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNKTLDRSGDLGDMEPLKGTTPLMQKI

• Full Name: catenin (cadherin-associated protein), delta 1
• Calculated Molecular Weight: 948 aa, 105 kDa
• Observed Molecular Weight: 75-120 kDa
• GenBank Accession Number: BC010501
• Gene Symbol: p120 Catenin
• Gene ID (NCBI): 1500
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60716
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Catenins were discovered as proteins that are linked to the cytoplasmic domain of transmembrane cadherins (PMID: 9653641). p120 catenin, also called p120 ctn or catenin delta-1(CTNND1), regulates cell-cell adhesion through its interaction with the cytoplasmic tail of classical and type II cadherins. p120 catenin is a tyrosine kinase substrate implicated in cell transformation by SRC, as well as in ligand-induced receptor signaling through the EGF receptor, the PDGF receptor, and the CSF1 receptor. Different expression patterns of p120 catenin in lobular and ductal carcinomas of the breast have been reported: membrane stain for ductal carcinoma and cytoplasmic stain for lobular carcinoma (PMID: 24966968). Different isoforms of p120 catenin are variably expressed in different tissues as a result of alternative splicing and the use of multiple translation initiation codons (PMID: 19150613).