CDKN2A/P14-ARF Polyclonal antibody

• 

  WB analysis using 31221-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 31221-1-AP (P14-ARF antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 31221-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 31221-1-AP (P14-ARF antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 31221-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using P14-ARF antibody (31221-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

CDKN2A/P14-ARF Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 31221-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Alternative reading frame ARF, p14ARF, p19ARF, CDKN2A, MTS1

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31221-1-AP targets CDKN2A/P14-ARF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33340

  Product name: Recombinant human ARF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-132 aa of NM_058195

  Sequence: MVRRFLVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPSGGAAAAPRRGAQLRRPRHSHPTRARRCPGGLPGHAGGAAPGRGAAGRARCLGPSARGPG

• Full Name: cyclin-dependent kinase inhibitor 2A
• Calculated Molecular Weight: 14kd
• Observed Molecular Weight: 14 kDa, 19 kDa
• GenBank Accession Number: NM_058195
• Gene Symbol: CDKN2A
• Gene ID (NCBI): 1029
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N726
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDKN2A locus on chromosome 9p21 encodes two transcripts/proteins INK4A and ARF. INK4A (also referred to as p16INK4A) specially blocks the CDK4 and CDK6 cyclin-dependent kinases that control the phosphorylation status of the retinoblastoma (RB) protein (PMID: 11584300, PMID: 8259215). ARF (known as p14ARF in human and p19ARF in mouse) has been designed as a positive regulator of p53 levels because, through its complexation with Mdm2 (HDM2 in human), it prevents mdm2-mediated cytoplasmic translocation and degradation of p53 (PMID: 9153396).