p57Kip2 Polyclonal antibody

• 

  WB analysis using 23317-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23317-1-AP (p57Kip2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 23317-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 23317-1-AP (p57Kip2 antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human placenta using 23317-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 23317-1-AP (p57Kip2 antibody at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human placenta using 23317-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 23317-1-AP (p57Kip2 antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human placenta using 23317-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 23317-1-AP (p57Kip2 antibody at dilution of 1:200 (under 40x lens).

• Featured Product
• KD/KO Validated

p57Kip2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23317-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, CoIP, ELISA

Synonyms

BWCR, BWS, CDKN1C, KIP2, p57, p57Kip2, WBS

---

Tested Applications

• Positive WB detected in: HeLa cells, SH-SY5Y cells, Jurkat cells
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 7 publications below
• IHC: See 2 publications below
• CoIP: See 1 publications below

Product Information

23317-1-AP targets p57Kip2 in WB, IHC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19849

  Product name: Recombinant human CDKN1C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-316 aa of BC067842

  Sequence: MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR

• Full Name: cyclin-dependent kinase inhibitor 1C (p57, Kip2)
• Calculated Molecular Weight: 316 aa, 32 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC067842
• Gene Symbol: p57 Kip2/CDKN1C
• Gene ID (NCBI): 1028
• RRID: AB_2879254
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49918
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDKN1C, also named as p57KIP2 and KIP2, belongs to the CDI family. CDKN1C is a potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. It is a negative regulator of cell proliferation. CDKN1C may play a role in maintenance of the non-proliferative state throughout life.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Clin Cancer Res; microRNA-221 Enhances MYCN via Targeting Nemo-like Kinase and Functions as an Oncogene Related to Poor Prognosis in Neuroblastoma.; Authors - Xiao-Yan He
human	WB	FASEB J; Downregulation of ALKBH5 rejuvenates aged human mesenchymal stem cells and enhances their therapeutic efficacy in myocardial infarction; Authors - Xiaoyan Gao
human	WB,IHC	Cancer Med; PIK3R3 is upregulated in liver cancer and activates Akt signaling to control cancer growth by regulation of CDKN1C and SMC1A; Authors - Weidong Lin ; KD Validated
human	WB,CoIP,IHC	Cell Death Dis; The FOXM1/RNF26/p57 axis regulates the cell cycle to promote the aggressiveness of bladder cancer.; Authors - Lu Yi
human	WB	Oncogene; Dual network analysis of transcriptome data for discovery of new therapeutic targets in non-small cell lung cancer; Authors - Yuquan Bai
human	WB	Mol Cell; CDK-independent role of D-type cyclins in regulating DNA mismatch repair; Authors - Gergely Rona