AKT Polyclonal antibody

AKT Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27809-1-AP

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

AKT 1, AKT1, EC:2.7.11.1, PKB, PKB ALPHA

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 27809-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 27809-1-AP (AKT antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 27809-1-AP
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 27809-1-AP (AKT antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse testis using 27809-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27809-1-AP (AKT antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse testis using 27809-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27809-1-AP (AKT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 27809-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27809-1-AP (AKT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 27809-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27809-1-AP (AKT antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A549 cells, NIH/3T3 cells, HEK-293 cells, HeLa cells, Jurkat cells
Positive IHC detected in	mouse testis tissue, human colon cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27809-1-AP targets AKT in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag26642 Product name: Recombinant human AKT protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 293-405 aa of BC000479 Sequence: FGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQH Predict reactive species
Full Name	v-akt murine thymoma viral oncogene homolog 1
Calculated Molecular Weight	56 kDa
Observed Molecular Weight	56-62 kDa
GenBank Accession Number	BC000479
Gene Symbol	AKT1
Gene ID (NCBI)	207
RRID	AB_3742259
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P31749
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AKT (also known as protein kinase B, PKB) is a serine threonine protein kinase consisting of three isoforms, AKT1, AKT2, and AKT3, which are encoded by three distinct genes, PKBα, PKBβ, and PKBγ, respectively. Among them, AKT1 is ubiquitously expressed and primarily regulates cell survival, AKT2 controls glucose metabolism, while AKT3 is highly expressed in the brain and testes. These isoforms are central nodes in the PI3K-AKT-mTOR signaling pathway, which is a critical regulator of cell survival, growth, proliferation, and metabolism (PMID: 25811375, PMID: 31173856, PMID: 36180910). This antibody detects total AKT1, AKT2, and AKT3 isoforms, typically showing a molecular weight of approximately 56-62 kDa in Western blot analysis.