Tested Applications
| Positive WB detected in | A549 cells, NIH/3T3 cells, HEK-293 cells, HeLa cells, Jurkat cells |
| Positive IHC detected in | mouse testis tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27809-1-AP targets AKT in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26642 Product name: Recombinant human AKT protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 293-405 aa of BC000479 Sequence: FGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQH Predict reactive species |
| Full Name | v-akt murine thymoma viral oncogene homolog 1 |
| Calculated Molecular Weight | 56 kDa |
| Observed Molecular Weight | 56-62 kDa |
| GenBank Accession Number | BC000479 |
| Gene Symbol | AKT1 |
| Gene ID (NCBI) | 207 |
| RRID | AB_3742259 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P31749 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AKT (also known as protein kinase B, PKB) is a serine threonine protein kinase consisting of three isoforms, AKT1, AKT2, and AKT3, which are encoded by three distinct genes, PKBα, PKBβ, and PKBγ, respectively. Among them, AKT1 is ubiquitously expressed and primarily regulates cell survival, AKT2 controls glucose metabolism, while AKT3 is highly expressed in the brain and testes. These isoforms are central nodes in the PI3K-AKT-mTOR signaling pathway, which is a critical regulator of cell survival, growth, proliferation, and metabolism (PMID: 25811375, PMID: 31173856, PMID: 36180910). This antibody detects total AKT1, AKT2, and AKT3 isoforms, typically showing a molecular weight of approximately 56-62 kDa in Western blot analysis.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for AKT antibody 27809-1-AP | Download protocol |
| WB protocol for AKT antibody 27809-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











