Pan-PAX Polyclonal antibody

Pan-PAX Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 21383-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

PAX-8, PAX8, PAX 8, Paired box protein Pax-8, Paired box protein Pax 8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSKOV-3 cells, A2780 cells
Positive IP detected inSKOV-3 cells
Positive IHC detected inhuman ovary cancer tissue, human kidney tissue, human renal cell carcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inSKOV-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:600-1:2400
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21383-1-AP targets Pan-PAX in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16018

Product name: Recombinant human pan-PAX protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 10-140 aa of BC001060

Sequence: HGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPF

Predict reactive species
Full Name paired box 8
Calculated Molecular Weight 450 aa, 48 kDa
Observed Molecular Weight 36-48 kDa
GenBank Accession NumberBC001060
Gene Symbol PAX8
Gene ID (NCBI) 7849
RRIDAB_10733094
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ06710
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PAX genes encode a family of developmentally regulated transcription factors that have been implicated in a number of human and murine congenital disorders, as well as in tumorigenesis. These genes are defined by the presence of an evolutionarily conserved DNA binding domain, termed the paired domain. Many paired domain-containing proteins recognize a common sequence motif. The immunogen of this atnibody is the Paired box domain of PAX family. This antibody is a Pan-PAX antibody.

Protocols

Product Specific Protocols
IF protocol for Pan-PAX antibody 21383-1-APDownload protocol
IHC protocol for Pan-PAX antibody 21383-1-APDownload protocol
IP protocol for Pan-PAX antibody 21383-1-APDownload protocol
WB protocol for Pan-PAX antibody 21383-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Life Sci

Notch-mediated Sox9+ cell activation contributes to kidney repair after partial nephrectomy.

Authors - Qiwang Ma
ratIHC

Sci Signal

Ubiquitination and functional modification of GluN2B subunit-containing NMDA receptors by Cbl-b in the spinal cord dorsal horn.

Authors - Zi-Yang Zhang
humanIHC

Am J Surg Pathol

PAX8 and PAX2 immunostaining facilitates the diagnosis of primary epithelial neoplasms of the male genital tract.

Authors - Tong Guo-Xia GX
MouseIHC

PLoS One

Mouse models of sporadic thyroid cancer derived from BRAFV600E alone or in combination with PTEN haploinsufficiency under physiologic TSH levels.

Authors - Mika Shimamura
mouseIHC

Endocrine

PMID: 32281047

Authors - Mika Shimamura
pigIF

PLoS One

PMID: 28231273

Authors - Sergio E Palma-Vera
Loading...
||
New chat Able
正在加载,请稍候...