Use Able AI chat for product recommendations

transgelin/SM22 Recombinant monoclonal antibody

transgelin/SM22 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 83922-2-RR
Clone No.240864A11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

SM22, transgelin, 22 kDa actin-binding protein, 240864A11, Protein WS3-10

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse colon tissue, rat colon tissue, mouse stomach tissue, rat stomach tissue
Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse heart tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83922-2-RR targets transgelin/SM22 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0764

Product name: Recombinant human TAGLN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-201 aa of BC004927

Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

Predict reactive species
Full Name transgelin
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 19-22 kDa
GenBank Accession NumberBC004927
Gene Symbol transgelin/SM22
Gene ID (NCBI) 6876
RRIDAB_3671502
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ01995
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The transgelin family is a protein group belonging to the 22kd actin-related calponin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, or SM22alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells. This antibody was generated against full-length transgelin 1 protein. It can cross-react with other two transgenes based on the sequence similarity.

Protocols

Product Specific Protocols
IF protocol for transgelin/SM22 antibody 83922-2-RRDownload protocol
IHC protocol for transgelin/SM22 antibody 83922-2-RRDownload protocol
WB protocol for transgelin/SM22 antibody 83922-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...