uPA/Urokinase Recombinant monoclonal antibody

• 

  WB analysis using 87458-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87458-1-RR (PLAU/uPA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of PC-3 using 87458-1-RR

  Immunofluorescent analysis of (-20°C Methanol) fixed PC-3 cells using uPA/Urokinase antibody (87458-1-RR, Clone: 252624A5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity of 87458-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87458-1-RR against Human uPA/Urokinase were performed. The affinity constant is 0.549 nM.

uPA/Urokinase Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87458-1-RR

Clone No.252624A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

PLAU, UPA, ATF, EC:3.4.21.73, u PA

---

Tested Applications

• Positive WB detected in: PC-3 cells, DU 145 cells
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87458-1-RR targets uPA/Urokinase in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg7083

  Product name: Recombinant human PLAU/uPA protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 21-431 aa of NM_002658.6

  Sequence: SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

• Full Name: plasminogen activator, urokinase
• Calculated Molecular Weight: 49kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: NM_002658.6
• Gene Symbol: Urokinase
• Gene ID (NCBI): 5328
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P00749-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLAU(Urokinase-type plasminogen activator) is also named as uPA and belongs to the peptidase S1 family.UPA initiates a proteolytic cascade, which degrades extracellular matrix during tissue growth and remodelling.The secreted proform of UPA is activated after binding to a specific high affinity cell surface receptor. Secreted UPA is exposed to rapid inactivation in the pericellular space by plasminogen activator inhibitor-1 (PAI-1), which is stored in the extracellular matrix bound to vitronectin(PMID:9665342).It has 2 isoforms produced by alternative splicing. Defects in PLAU are the cause of Quebec platelet disorder (QPD).