uPAR/CD87 Recombinant monoclonal antibody, PBS Only

uPAR/CD87 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 82953-2-PBS
Clone No.230148B10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

uPAR, PLAUR, PLAUR, 230148B10, CD87, MO3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82953-2-PBS targets uPAR/CD87 in WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag28056

Product name: Recombinant human uPAR, PLAUR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 23-305 aa of BC002788

Sequence: LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG

Predict reactive species
Full Name PLAUR
Calculated Molecular Weight 37 kDa
Observed Molecular Weight35-50 kDa
GenBank Accession NumberBC002788
Gene Symbol uPAR
Gene ID (NCBI) 5329
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ03405
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

uPAR is a highly glycosylated, GPI-anchored membrane protein. In addition to the membrane-anchored form, uPAR is released from the plasma membrane by cleavage of the GPI anchor and can be found as a soluble form (suPAR). uPAR contains three homologous domains (D1-D3) of which the N-terminal one (D1) represents the uPA-binding domain. After binding to uPAR, uPA cleaves plasminogen, generating the active protease plasmin which is involved in a wide variety of physiologic and pathologic processes. In addition to regulating proteolysis, uPAR has important function in cell adhesion, migration and proliferation. Studies reveal that uPAR expression is elevated during inflammation and tissue remodeling and in many human cancers, in which it frequently indicates poor prognosis. (PMID 20027185; 12461559)

Loading...
||
New chat Able
正在加载,请稍候...