VWF Recombinant monoclonal antibody, PBS Only

VWF Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

Cat No. 83854-2-PBS
Clone No.240867D10

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

VWF, VWFpp, 240867D10, F8VWF, von Willebrand antigen II, VWD

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83854-2-PBS targets VWF in WB, IHC, IF-P, Cytometric bead array, Indirect ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25578

Product name: Recombinant human vwf protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 754-854 aa of

Sequence: MSSPLSHRSKRSLSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCQD

Predict reactive species
Full Name von Willebrand factor
Observed Molecular Weight309-320 kDa
Gene Symbol VWF
Gene ID (NCBI) 7450
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04275
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Von Willebrand factor (VWF) is a large multimeric glycoprotein found in blood plasma involved in hemostasis following vascular injury. Due to the multimeric nature of VWF, it can range in size from 500 to 20,000 kDa due to the differences in the number of subunits comprising the protein. Each subunit is approximately 250 kDa (PMID: 9759493). The biosynthesis of VWF in vivo is limited to endothelial cells (PMID: 4209883) and megakaryocytes (PMID: 2413071). VWF synthesized in endothelial cells is either released directly into the plasma via 27186a secretory pathway, or tubulized and stored in organelles unique to this cell type called Weibel-Palade bodies (PMID: 16459301). Whereas VWF synthesized in megakaryocytes is stored in the alpha granules of platelets (PMID: 2046403). The primary function of VWF is as an adhesive plasma glycoprotein, particularly factor VIII; an essential blood-clotting protein (PMID: 6982084). VWF is also important in platelet adhesion to wound sites by binding specifically to type I and type III collagen (PMID: 11098050), with larger VWF multimers being most effective (PMID: 24448155).

Loading...
||
New chat Able
正在加载,请稍候...