A1CF Recombinant monoclonal antibody

A1CF Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 84322-4-RR

Clone No. 241644F10

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

241644F10, ACF, ACF64, ACF65, APOBEC1 complementation factor

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllWBIHCAffinity

WB analysis using 84322-4-RR
Various lysates were subjected to SDS PAGE followed by western blot with 84322-4-RR (A1CF antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse colon using 84322-4-RR
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 84322-4-RR (A1CF antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse colon using 84322-4-RR
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 84322-4-RR (A1CF antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Affinity and Kinetic Characterization of 84322-4-RR
Biolayer interferometry (BLl) kinetic assays of 84322-4-RR against Human A1CF were performed. The affinity constant is 0.191 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for A1CF in ?

Positive WB detected in	mouse liver tissue, rat liver tissue
Positive IHC detected in	mouse colon tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

84322-4-RR targets A1CF in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag22929 Product name: Recombinant human A1CF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC054873 Sequence: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIR Predict reactive species
Full Name	APOBEC1 complementation factor
Calculated Molecular Weight	594 aa, 65 kDa
Observed Molecular Weight	65 kDa
GenBank Accession Number	BC054873
Gene Symbol	A1CF
Gene ID (NCBI)	29974
RRID	AB_3671864
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purfication
UNIPROT ID	Q9NQ94
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.